PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10028223m
Common NameCICLE_v10028062mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family bZIP
Protein Properties Length: 515aa    MW: 55482 Da    PI: 6.6562
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10028223mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.76.6e-10434491562
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                      kr++r   NR +A rs +RK  +i eLe kv++L++e ++L  +l  l+  +  l+++
  Ciclev10028223m 434 KRAKRILANRQSAARSKERKMRYISELEHKVQTLQTEATTLSAQLTLLQRDSVGLTNQ 491
                      9********************************************9998877666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.2E-18430494IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.737432495IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.67E-11434485No hitNo description
PfamPF001709.8E-9434488IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.2E-9434490No hitNo description
CDDcd147037.85E-25435484No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 515 aa     Download sequence    Send to blast
MGGDSDEGNG GNTDMMQRIQ SSFGTSSSSI PKQQTLLSAN QLDLPQLNQN QLRARHFSQF  60
ATNFGGDSSK RVGIPPSHPN QIPPISPYSS IPVSRPGNQQ MGSQNYSPGP THSRSLSQPS  120
LFFSLDSLPP LSPSPFRDSP STSMSDQVST DVSMEDRDGN SHSLLPPSPF NRGNASRIGE  180
SLPPRNKHRR SNSDIPFGFS TVMQSSSPLI SPRFAGGLDK AVSGRENPGV AKPAQLVKKE  240
SSWERGGESN GEGMGERKSE GEVVDDLFSA YMNLENIDAL NSSGTDDKNG NENREDLDSR  300
ASGTKTNGGD SSDNEAESSV NESGNSLQRA GMNSSAEKRE GIKRTAGGDV ASTTRHYRSV  360
SMDSFMGKLN FGDESPKLPP SPGTRPGQLS PSNSIDANSP AFSLEFGNGE FSGAELKKIM  420
ANEKLAEIAL TDPKRAKRIL ANRQSAARSK ERKMRYISEL EHKVQTLQTE ATTLSAQLTL  480
LQRDSVGLTN QNNELKFRLQ AMEQQAQLRD GIIL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006423514.10.0hypothetical protein CICLE_v10028062mg
TrEMBLV4UBU80.0V4UBU8_9R
STRINGPOPTR_0009s12830.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-139bZIP family protein